Protein coding transcript 157644

• Transcript: Ll_transcript_105141
• CDS coordinates: 247-696 (+)
• Peptide sequence: MSILFPESVLSNRQRVIRELLQGHDCATKLKFLLQNPIGSYGSTLSAEELLSNVERSFTKTIYVVTSSDTEVFDENGSHVGANSCNDLRSEDSTKSKKRSLTTTIKDRRGSYKRRRTAQTWTKISETIDDNHAWRKYGQKEILNSKFPR*
• ORF Type: complete

Annotations of Ll_transcript_105141

• Blastp: Probable WRKY transcription factor 70 from Arabidopsis with 40.71% of identity
• Blastx: Probable WRKY transcription factor 70 from Arabidopsis with 40% of identity
• Eggnog: Transcription factor(ENOG410YZZY)
• Kegg: Link to kegg annotations (AT3G56400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414293.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;