Transcript | Ll_transcript_106010 |
---|---|
CDS coordinates | 251-583 (+) |
Peptide sequence | MATPLMAGLAVAAAAYAGRYGIQAWQAFKARPPTMRKFYEGGFQPTMTRREAALILGVRERTPTDKIKEAHRRVMIANHPDAGGSHYLASKINEAKDMLVGKTKGSGSAF* |
ORF Type | complete |
Blastp | Mitochondrial import inner membrane translocase subunit TIM14-1 from Arabidopsis with 78.57% of identity |
---|---|
Blastx | Mitochondrial import inner membrane translocase subunit TIM14-3 from Arabidopsis with 80.36% of identity |
Eggnog | DNAj domain protein(COG2214) |
Kegg | Link to kegg annotations (AT2G35795) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459165.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer