Protein coding transcript 157710

• Transcript: Ll_transcript_106481
• CDS coordinates: 117-863 (+)
• Peptide sequence: MQICMSHILSVLKVPQDRDSGFIALGEMAGALDGELIHYLPTITTHLRDAIAPRRSKPSLEALACIGSIAKAMGPAMEPHVRGLLDIMFSTGLSTVLVEALEQICTSIPSLLPTIQDRLLDSISMVLLKSHYHLGRLATSMGRGTAMNASQQFSELTGSALVQLALQTLARFNFKGHDLLEFVRESVVLYLDDEDGATRKDAALCCCKIVSNSFSGILCAHFGSSRLNRPGGGKRRRLVEELLKSSIF*
• ORF Type: complete

Annotations of Ll_transcript_106481

• Blastp: Serine/threonine-protein kinase TOR from Arabidopsis with 67.62% of identity
• Blastx: Serine/threonine-protein kinase TOR from Arabidopsis with 67.48% of identity
• Eggnog: phosphatidylinositol kinase activity(COG5032)
• Kegg: Link to kegg annotations (AT1G50030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423211.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;