Protein coding transcript 157759

• Transcript: Ll_transcript_106092
• CDS coordinates: 1523-2689 (+)
• Peptide sequence: MYMQNNQFTGTINILANLPLKFLNVENNHFTGWIPEQLQNINIQAGSNAWSSGPVPPPPPGTPPAPKSNQHHKPGGGSTSHSGSDSDTSEGGKKSGIGGGGIAGILISIVVIGAIVAFFLVKRRKSKKASSDLEKLENQSFASLPSNELHHEVKLQTSSLIDPKMFDTSSSINLKPPPIDRYKSFDENELSKKPIVVKKTVSVPANLKSYSIADLQIATGSFSVDHLVGEGSFGRVYRAQFDEGKVLAVKKIDSSVLPNNLSEDFTDIVSNISHLHHPNVTELVGYCSEYGQHLLVYEFHKNGSLHDFLHLEDEYSKPLIWNTRVKIALGTARALEYLHEVCSPSVVHKNIKSTNILLDAELSPHLSDSGLASYIPNADQVLNHNIGSG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_106092

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 6 from Arabidopsis with 61.32% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 6 from Arabidopsis with 68.3% of identity
• Eggnog: strubbelig-receptor family(ENOG410XUXK)
• Kegg: Link to kegg annotations (AT1G53730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423659.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;