Transcript | Ll_transcript_106096 |
---|---|
CDS coordinates | 257-1423 (+) |
Peptide sequence | MYMQNNQFTGTINILANLPLKFLNVENNHFTGWIPEQLQNINIQAGSNAWSSGPVPPPPPGTPPAPKSNQHHKPGGGSTSHSGSDSDTSEGGKKSGIGGGGIAGILISIVVIGAIVAFFLVKRRKSKKASSDLEKLENQSFASLPSNELHHEVKLQTSSLIDPKMFDTSSSINLKPPPIDRYKSFDENELSKKPIVVKKTVSVPANLKSYSIADLQIATGSFSVDHLVGEGSFGRVYRAQFDEGKVLAVKKIDSSVLPNNLSEDFTDIVSNISHLHHPNVTELVGYCSEYGQHLLVYEFHKNGSLHDFLHLEDEYSKPLIWNTRVKIALGTARALEYLHEVCSPSVVHKNIKSTNILLDAELSPHLSDSGLASYIPNADQVLNHNIGSG |
ORF Type | 3prime_partial |
Blastp | Protein STRUBBELIG-RECEPTOR FAMILY 6 from Arabidopsis with 61.32% of identity |
---|---|
Blastx | Protein STRUBBELIG-RECEPTOR FAMILY 7 from Arabidopsis with 58.12% of identity |
Eggnog | strubbelig-receptor family(ENOG410XUXK) |
Kegg | Link to kegg annotations (AT1G53730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423659.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer