Protein coding transcript 157763

• Transcript: Ll_transcript_106098
• CDS coordinates: 301-1359 (+)
• Peptide sequence: MEKGGRVVVLFTSACILLWMAIVVNGDTDPNDATSIRILFQGLNSAPQLGWPSNGNGDDPCGQFWKGITCSVNRVTEINLSNLGLTGTLPYGLKPLTSLTNLDLSSNNLGGTIPYEIPPNVKRLNLANNNLTGNIPFSFSDLTSLTDLNLGHNQLQQGLSFDFSRLSTLSTLDVSFNALTGDLPQSLSLLPDITSMYMQNNQFTGTINILANLPLKFLNVENNHFTGWIPEQLQNINIQAGSNAWSSGPVPPPPPGTPPAPKSNQHHKPGGGSTSHSGSDSDTSEGGKKSGIGGGGIAGILISIVVIGAIVAFFLVKRRKSKKASSDLEKLENQSFASLPSNELHHGILHTI*
• ORF Type: complete

Annotations of Ll_transcript_106098

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 6 from Arabidopsis with 48.73% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 6 from Arabidopsis with 71.86% of identity
• Eggnog: strubbelig-receptor family(ENOG410XUXK)
• Kegg: Link to kegg annotations (AT1G53730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423659.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;