Protein coding transcript 157800

• Transcript: Ll_transcript_104741
• CDS coordinates: 390-953 (+)
• Peptide sequence: MGEEAKQEQPKAESKPDNKAEENKEEKPAEEKPGEVKKEEKPSEEKPADEEKKEEPKPPAPCVLFVDLHCMGCAKKIERSIMKMRGVEGVVIDMAKNEVTIKGIVEPQAICNTITKKTKRRANVISPLPTAEGEPIPEVVNSQVSGPVTVELNVNMHCEACAQQLKKKILQMRGVQTAVTELSTGKVM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_104741

• Blastp: Heavy metal-associated isoprenylated plant protein 9 from Arabidopsis with 71.65% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 9 from Arabidopsis with 71.65% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT5G24580)
• CantataDB: Link to cantataDB annotations (CNT0000122)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459127.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;