Transcript | Ll_transcript_104751 |
---|---|
CDS coordinates | 65-697 (+) |
Peptide sequence | MASCGAKWRVLRDLVTVSFLLLLITVLVSGKRSSKSEESETNGSQRFSFLVNNAMKFLWGHAGYQHVWPELEFGWQIIFGTLIGIFGAAFGSVGGVGGGGIFVPMLVLVIGFDTKSATAISKCMLTGAAISTVLYNWKLKHPTLDIPIIEYDLVLLMQPILMLGISIGVTLSVIFAGWMVTVLLIILFIGNITRFFLQQGFKKIISNMIR* |
ORF Type | complete |
Blastp | Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 58.62% of identity |
---|---|
Blastx | Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 58.42% of identity |
Eggnog | cereblon(ENOG410XQGE) |
Kegg | Link to kegg annotations (AT2G25737) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458948.1) |
Pfam | Sulfite exporter TauE/SafE (PF01925.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer