Protein coding transcript 157806

• Transcript: Ll_transcript_104751
• CDS coordinates: 65-697 (+)
• Peptide sequence: MASCGAKWRVLRDLVTVSFLLLLITVLVSGKRSSKSEESETNGSQRFSFLVNNAMKFLWGHAGYQHVWPELEFGWQIIFGTLIGIFGAAFGSVGGVGGGGIFVPMLVLVIGFDTKSATAISKCMLTGAAISTVLYNWKLKHPTLDIPIIEYDLVLLMQPILMLGISIGVTLSVIFAGWMVTVLLIILFIGNITRFFLQQGFKKIISNMIR*
• ORF Type: complete

Annotations of Ll_transcript_104751

• Blastp: Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 58.62% of identity
• Blastx: Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 58.42% of identity
• Eggnog: cereblon(ENOG410XQGE)
• Kegg: Link to kegg annotations (AT2G25737)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458948.1)
• Pfam: Sulfite exporter TauE/SafE (PF01925.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;