Protein coding transcript 157866

• Transcript: Ll_transcript_105446
• CDS coordinates: 342-779 (+)
• Peptide sequence: MNSLHFLLSLFLLVVAFPNPHMVYGNAELRALMDLKSSLDPEGKLLSSWTNDGDPCSGSFEGVVCNEHHKVANISLPGRGLIGQVSSAVAELRCLSGLYLHYNFLSGEIPREISNLNELVDLYLNMNNLSGTIPSEIGNMASLQG*
• ORF Type: complete

Annotations of Ll_transcript_105446

• Blastp: LRR receptor kinase SERK2 from Oryza sativa with 34.06% of identity
• Blastx: Somatic embryogenesis receptor kinase 5 from Arabidopsis with 37.58% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4329032)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446670.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;