Protein coding transcript 157918

• Transcript: Ll_transcript_107192
• CDS coordinates: 402-1133 (+)
• Peptide sequence: MNYVVSGYTETLDKNSVLEVPDDDHGLYAIDILDPSLFTKLIHLTDVYHFHDMIDMLVGCGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKKSGGRKVNLISHSMGGILILCFMSLHNDLFSKYVKKWICMACPFQGAPGCVNDALLTGLQFVDGFESYFFVSRWSMHQLLIECPSLYEMLPNPEYKWKKQPGIHVWRKHAKNGETNINLESYGPAQSYSLFKEALRNNEVLCLNFS*
• ORF Type: complete

Annotations of Ll_transcript_107192

• Blastp: Phospholipase A(1) LCAT3 from Arabidopsis with 71.67% of identity
• Blastx: Phospholipase A(1) LCAT3 from Arabidopsis with 71.67% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT3G03310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433837.1)
• Pfam: Lecithin:cholesterol acyltransferase (PF02450.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;