Protein coding transcript 157935

• Transcript: Ll_transcript_106611
• CDS coordinates: 2-436 (+)
• Peptide sequence: HQEMELISKLQNPFIVEYKDSWVEKGCYVCIIIGYCEGGDMAEAIKKANGVMFPEEKLCKWLVQLLMALDYLHAKHILHRDVKCSNIFLTKDRDIRLGDFGLAKILSSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCI
• ORF Type: internal

Annotations of Ll_transcript_106611

• Blastp: Serine/threonine-protein kinase Nek3 from Arabidopsis with 91.72% of identity
• Blastx: Serine/threonine-protein kinase Nek3 from Arabidopsis with 91.72% of identity
• Eggnog: NIMA-related kinase(ENOG410Y7JF)
• Kegg: Link to kegg annotations (AT5G28290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452213.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;