Protein coding transcript 157938

• Transcript: Ll_transcript_106584
• CDS coordinates: 2-325 (+)
• Peptide sequence: HQEMELISKLQNPFIVEYKDSWVEKGCYVCIIIGYCEGGDMAEAIKKANGVMFPEEKLCKWLVQLLMALDYLHAKHILHRDVKVSNRLLFVCRTVFLFPSKFCQGTY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_106584

• Blastp: Serine/threonine-protein kinase Nek3 from Arabidopsis with 87.64% of identity
• Blastx: Serine/threonine-protein kinase Nek3 from Arabidopsis with 87.64% of identity
• Eggnog: NIMA-related kinase(ENOG410Y7JF)
• Kegg: Link to kegg annotations (AT5G28290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429154.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;