Protein coding transcript 157949

• Transcript: Ll_transcript_106589
• CDS coordinates: 300-881 (+)
• Peptide sequence: MGTHTVAAHQVMIQTFVMCTVWGEPLSQTAQSFMPELIYGANRSLSKARLLLRSLVIIGATLGFFLGIVGTCVPWLFPHIFTHDQVVIGEMHKVLLPYFVGLAVTPPTHSLEGTLMAGRDLNFMSLSMTGCLCLGSLVLWFLSSRSGLQGCWIALAGFQWARFSLALRRLLSPTGILYLENVDQREVQKLSTT*
• ORF Type: complete

Annotations of Ll_transcript_106589

• Blastp: Protein DETOXIFICATION 46, chloroplastic from Arabidopsis with 65.97% of identity
• Blastx: Protein DETOXIFICATION 46, chloroplastic from Arabidopsis with 66.34% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT2G21340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454217.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;