Protein coding transcript 157992

• Transcript: Ll_transcript_105186
• CDS coordinates: 1-684 (+)
• Peptide sequence: VNDSMTWQWRIGLLTWQLLQPEIQSFISLSLSLHLHPTTIPIHSYSYSCSNSYSCSYSYSYSPFLFQFSGLKIQHMMKGALFLILLSYFVFVTHAFSQQIFPANLGSTFGGGSSHEPKYKIEFHQQHSPFHPDDDQESIVIPDKNGQKFICYLPKVEKEKSGKPVIQTNISSMIVGTEKRIKQKMPDELLEVLKGPCFIRVSIYISLFVLNGDILIMIHYGLIVYFF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_105186

• Blastp: Protein OS-9 homolog from Arabidopsis with 46.67% of identity
• Blastx: Protein OS-9 homolog from Arabidopsis with 40% of identity
• Eggnog: glycoprotein binding(ENOG410XR8A)
• Kegg: Link to kegg annotations (AT5G35080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416989.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;