Protein coding transcript 1581

• Transcript: Ll_transcript_452825
• CDS coordinates: 3-320 (+)
• Peptide sequence: QIEKKLLKRGFQFNVICVGQTGLGKSTLINTIFASNLVKSKGRLSPTEPIRQTSEIQAVTHVVEENGVRLRLNIVDTPGYGDLVNNDRCWDPIVKYIKDQHSAYLR
• ORF Type: internal

Annotations of Ll_transcript_452825

• Blastp: Cell division control protein 10 from Candida with 61.32% of identity
• Blastx: Cell division control protein 10 from Candida with 61.32% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAALFM_CR04570CA)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419770.1)
• Pfam: Septin (PF00735.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;