Protein coding transcript 158189

• Transcript: Ll_transcript_106771
• CDS coordinates: 634-1137 (+)
• Peptide sequence: MGEPILKASDVPTKLPPNKDHAVVKSELDVDGTIWNVTCVSMGNPHCITFSGKGFENLFVDELKLAEIGPKFEHHEVFPARTNTEFVQVLSESHLKMRVWERGAGATLACGTGACATVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHIYMTGSAELVYYGSLPL*
• ORF Type: complete

Annotations of Ll_transcript_106771

• Blastp: Diaminopimelate epimerase, chloroplastic from Arabidopsis with 80.24% of identity
• Blastx: Diaminopimelate epimerase, chloroplastic from Arabidopsis with 80.32% of identity
• Eggnog: Catalyzes the stereoinversion of LL-2,6- diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso- DAP), a precursor of L-lysine and an essential component of the bacterial peptidoglycan (By similarity)(COG0253)
• Kegg: Link to kegg annotations (AT3G53580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444390.1)
• Pfam: Diaminopimelate epimerase (PF01678.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;