Protein coding transcript 158211

• Transcript: Ll_transcript_107093
• CDS coordinates: 792-1766 (+)
• Peptide sequence: MTPLNHLSEGPGNEKLRELLNWHLEEQRKKRAIEACGETKAKMDELEKELAYIVGLHDLKMQLRKWAKGMLLDERRRALGLHVGTRRPPHMAFLGNPGTGKTMVARVLGKLLHMVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLIPMQKSDDKDYGLEALEEIMSVMDRGKIVVIFAGYDEPMKRVIASNEGFCRRVTKFFHFNDFNSEELAEILHIKMKNLAADSLLYGFKLHPSCSIETLAALIESVTTEKQRKESNGGLIDTMLVNARENLDLRLSFECIDTEELLTITLVDLEAGLRLLSQ*
• ORF Type: complete

Annotations of Ll_transcript_107093

• Blastp: Protein CfxQ homolog from Cyanidioschyzon with 41% of identity
• Blastx: Protein CfxQ homolog from Cyanidioschyzon with 41% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (CymeCp015)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448390.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;