Transcript | Ll_transcript_107096 |
---|---|
CDS coordinates | 248-1219 (+) |
Peptide sequence | MNISHHQRSRSSKPPTVHGYARSGDLLGFQRLLRDNPSLLNEANPIMAQTPLHVSAGDNRAEIVQFLLGWQGPGRVELEAKNMYGETPLHMAAKNGCSESAQLLLSHGAFVEARANNGMTPLHLAVWHSLRAGEFLTVKVLLEYNADCSAKDDEGMTPLNHLSEGPGNEKLRELLNWHLEEQRKKRAIEACGETKAKMDELEKELAYIVGLHDLKMQLRKWAKGMLLDERRRALGLHVGTRRPPHMAFLGNPGTGYILQIVFGLYCFAEYCKLVLLCSLHLLSLFCSYHFVVQDFFSLVFLLNFHVSIASISAPSPFCIYAFV* |
ORF Type | complete |
Blastp | Ankyrin-3 from Homo with 36.48% of identity |
---|---|
Blastx | Protein CfxQ homolog from Cyanidioschyzon with 43.38% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (288) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448390.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer