Protein coding transcript 158215

• Transcript: Ll_transcript_107101
• CDS coordinates: 180-1100 (+)
• Peptide sequence: MNRSHEKRLRSPKPPTIHGYAHSGDVIGFQRLLRDIPSLLNETNPVMAQTPLHVSAGHNRAEIVQFLLDWQGPGRVELEAKNMYGETPLHMAAKNGCSEAARVLLTHGAFVEARANNGMTPLHLAVWHSLQAEEFLTVKVLLEYNADCSAKDNEGMTPLNHLSQGPGNEKLRELLNWNLEEQRKRRAIEACGETKAKMDELEKELGYIVGLNDLKVQLRKWAKGMLLDERRRALGLHVGTRRPPHMAFLGNPGTGKTMVARILGKLLHMVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKVCSGF*
• ORF Type: complete

Annotations of Ll_transcript_107101

• Blastp: Stage V sporulation protein K from Bacillus with 42.16% of identity
• Blastx: Stage V sporulation protein K from Bacillus with 40.35% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (BSU17420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458783.1)
• Pfam: Ankyrin repeats (many copies) (PF13857.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;