Protein coding transcript 158218

• Transcript: Ll_transcript_107109
• CDS coordinates: 248-1219 (+)
• Peptide sequence: MNISHHQRSRSSKPPTVHGYARSGDLLGFQRLLRDNPSLLNEANPIMAQTPLHVSAGDNRAEIVQFLLGWQGPGRVELEAKNMYGETPLHMAAKNGCSESAQLLLSHGAFVEARANNGMTPLHLAVWHSLRAGEFLTVKVLLEYNADCSAKDDEGMTPLNHLSEGPGNEKLRELLNWHLEEQRKKRAIEACGETKAKMDELEKELAYIVGLHDLKMQLRKWAKGMLLDERRRALGLHVGTRRPPHMAFLGNPGTGYILQIVFGLYCFAEYCKLVLLCSLHLLSLFCSYHFVVQDFFSLVFLLNFHVSIASISAPSPFCIYAFV*
• ORF Type: complete

Annotations of Ll_transcript_107109

• Blastp: Ankyrin-3 from Homo with 36.48% of identity
• Blastx: Protein CfxQ homolog from Guillardia with 41.86% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (288)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448390.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;