| Transcript | Ll_transcript_104913 |
|---|---|
| CDS coordinates | 1711-2025 (+) |
| Peptide sequence | MVLMNFCALCMQLSSSNFFQPSGSARRRAVSGGHDAVVGSETEPSRPPIMDSSQGALSKISGAQRNSTILPSDHNRVASGRNTSNVMNLETTLKGIEIRDPSIQ* |
| ORF Type | complete |
| Blastp | Casein kinase 1-like protein 2 from Arabidopsis with 47.73% of identity |
|---|---|
| Blastx | Casein kinase 1-like protein 2 from Arabidopsis with 89.47% of identity |
| Eggnog | Casein Kinase(ENOG410XPGP) |
| Kegg | Link to kegg annotations (AT1G72710) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424507.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer