Protein coding transcript 158313

• Transcript: Ll_transcript_104927
• CDS coordinates: 1-375 (+)
• Peptide sequence: LEDLFNFCNRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQVYCIDFGLAKKYKDSSTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPW
• ORF Type: internal

Annotations of Ll_transcript_104927

• Blastp: Casein kinase 1-like protein 1 from Arabidopsis with 92.8% of identity
• Blastx: Casein kinase 1-like protein 1 from Arabidopsis with 92.8% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G26100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437556.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;