Protein coding transcript 158319

• Transcript: Ll_transcript_104919
• CDS coordinates: 3-869 (+)
• Peptide sequence: MINRVEYVHSKSYLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDNSTHQHIPYRENRNLTGTARYASMNTHLGIEQSRRDDLESLGFVLMYFLRGSLPWQGLKAGNKKQKYEKISEKKVSTSIESLCHGYPSEFASYFHYCRSLRFDDKPDYAYLKRLFRDLFIREGLQFDYVFDWNILKYQQSQISAPPVRAIGAIAGPSSGMPPLVNANGQTGGQDGRHTGWSSSVPIRRRNSGPIANDGILSRQKDPVTSDTAGSKEVKVHNYIYNNGNTFACELGIILQKL*
• ORF Type: complete

Annotations of Ll_transcript_104919

• Blastp: Casein kinase 1-like protein 2 from Arabidopsis with 81.13% of identity
• Blastx: Casein kinase 1-like protein 2 from Arabidopsis with 81.13% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT1G72710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448236.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;