Protein coding transcript 158364

• Transcript: Ll_transcript_104874
• CDS coordinates: 246-755 (+)
• Peptide sequence: MESSQGSRSSTTTLAGLVENASSIQRDETRVDGIPIYVKELIAGGFAGALSKTTVAPLERVKILWQTRIAGFHTLGVYQSLNKLVKHEGFVGLYKGNGASVIRIIPYAALHFMTYERYKSWILNNYPMLGTGPFIDLLAGSAAGGTSVLCTYPLDLARTKLAYQVWISF*
• ORF Type: complete

Annotations of Ll_transcript_104874

• Blastp: Mitochondrial carrier protein CoAc1 from Zea with 65.66% of identity
• Blastx: Mitochondrial carrier protein CoAc1 from Zea with 65.66% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (100193242)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437844.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;