Protein coding transcript 158380

• Transcript: Ll_transcript_106384
• CDS coordinates: 147-719 (+)
• Peptide sequence: MGFLLTPLFLSLFLLFSHQTNAHNLNLFATNATTPTTNNTSSVRKLSGRCNLFRGKWVYDPSYPLYDPSTCPFIDPQFNCQKYGRPDSLYQKYRWQPLSCSIPRFNAFDFLAKYKGKKIMFVGDSLSLNQFNSLACMIHSSVPKTRTTFTKNGALSTVTFQVGFYVIVLSLETFAFNGGVGNDNCLVFFM*
• ORF Type: complete

Annotations of Ll_transcript_106384

• Blastp: Protein trichome birefringence-like 39 from Arabidopsis with 64.06% of identity
• Blastx: Protein trichome birefringence-like 39 from Arabidopsis with 67.83% of identity
• Eggnog: function domain containing protein, expressed(ENOG410YAJT)
• Kegg: Link to kegg annotations (AT2G42570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437028.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;