Transcript | Ll_transcript_106837 |
---|---|
CDS coordinates | 2369-2986 (+) |
Peptide sequence | MAEPDHIFVNPLPNLASRTQPAGFPFFYIKPAENEKIIRKFYPEEKGPVTDVDPIGNSPVIIQKSLMEEIAPSWVNISLRMKDDPETDKAFGWVLEMYAYAVASALHGVKHILRKDFMLQPPWDLHVGKKFIIHYTYGCDYNLKGELTYGKIGEWRFDKRSHLTSPPPKNLSLPPPGVPESVVRLVKMVNEATANIPEWDTLNRI* |
ORF Type | complete |
Blastp | Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 78.71% of identity |
---|---|
Blastx | Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 78.17% of identity |
Eggnog | NA(ENOG410Z627) |
Kegg | Link to kegg annotations (AT5G13500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459109.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer