Protein coding transcript 158422

• Transcript: Ll_transcript_106837
• CDS coordinates: 2369-2986 (+)
• Peptide sequence: MAEPDHIFVNPLPNLASRTQPAGFPFFYIKPAENEKIIRKFYPEEKGPVTDVDPIGNSPVIIQKSLMEEIAPSWVNISLRMKDDPETDKAFGWVLEMYAYAVASALHGVKHILRKDFMLQPPWDLHVGKKFIIHYTYGCDYNLKGELTYGKIGEWRFDKRSHLTSPPPKNLSLPPPGVPESVVRLVKMVNEATANIPEWDTLNRI*
• ORF Type: complete

Annotations of Ll_transcript_106837

• Blastp: Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 78.71% of identity
• Blastx: Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 78.17% of identity
• Eggnog: NA(ENOG410Z627)
• Kegg: Link to kegg annotations (AT5G13500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459109.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;