Protein coding transcript 158427

• Transcript: Ll_transcript_106825
• CDS coordinates: 750-1358 (+)
• Peptide sequence: MAEPDHVFVRPLPNLAHGGHPAAFPFFYIRPDQNEKVIRKFYPEEYGPVTNVDPIGNSPVIIRKDLIAKIAPTWMNVSLKMKEDPETDKAFGWVLEMYAYAVASALHGVRHILRKDFMLQPPWDLETTNKYIIHYTYGCDYNLKGELTYGKIGEWRFDKRSHLRGPPPRNLPLPPPGVPESVVTLVKMVNEASANIPNWDTS*
• ORF Type: complete

Annotations of Ll_transcript_106825

• Blastp: Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 83.58% of identity
• Blastx: Hydroxyproline O-arabinosyltransferase 3 from Arabidopsis with 83.74% of identity
• Eggnog: NA(ENOG410Z627)
• Kegg: Link to kegg annotations (AT5G13500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453517.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;