Protein coding transcript 158469

• Transcript: Ll_transcript_105667
• CDS coordinates: 336-794 (+)
• Peptide sequence: MEAMSIERKRTLVEKVRKDSMVEKEVENEVEEEYENGGVGLTEEVRKKGIDGSKGSSSGGGGVSPPSCQAERCGADLTDAKKYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKTTADYNGEGFH*
• ORF Type: complete

Annotations of Ll_transcript_105667

• Blastp: Squamosa promoter-binding protein 2 from Antirrhinum with 69.47% of identity
• Blastx: Squamosa promoter-binding protein 1 from Antirrhinum with 78.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450579.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;