Protein coding transcript 158471

• Transcript: Ll_transcript_105676
• CDS coordinates: 327-779 (+)
• Peptide sequence: MEARSNERKRTLVENVRKGSTVEEVENEVEEEYESVSVEHLTEEEKKKGVGGRKGSSSGGVSPPSCQAEKCGADMTNAKKYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKTTADYNGEGFH*
• ORF Type: complete

Annotations of Ll_transcript_105676

• Blastp: Squamosa promoter-binding protein 1 from Antirrhinum with 66.99% of identity
• Blastx: Squamosa promoter-binding protein 1 from Antirrhinum with 81.01% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014493466.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;