Protein coding transcript 158481

• Transcript: Ll_transcript_106803
• CDS coordinates: 86-1174 (+)
• Peptide sequence: MLFHSTTPLLNPQPYTLFSPFPFFLSTPIPRNLLSLQTLYFPTHCNHVLGDSLVFEDAIFEHPILPNNINSYNLIKPRKKKKKQKRNVAPPQIVPDNLVPEKWRKIQDEINIAKNESKKIAEEVELNSKVEKKRRALILLKDLNMDRYKAYKEAKLAQLKPLVLDNPSRFPVKEEDFVEKEEDGYDDDDDEFGGSERVKPKNPRLAVYGKSLEDVSEFLNSEYYEPHANKSSQGHQKLFTKEEKVLLKKGIPDLASATSDKWLPLHTLAACGEFYLVDSLMKHNVDINAVDKDGLTALHKAIIAKNQAITNYLLINSANPFVKDKVGENYFSLRFTIIFAYVCLYLLVFFSKVNFDTLPIIS*
• ORF Type: complete

Annotations of Ll_transcript_106803

• Blastp: Ankyrin repeat domain-containing protein, chloroplastic from Arabidopsis with 46.18% of identity
• Blastx: Ankyrin repeat domain-containing protein, chloroplastic from Arabidopsis with 44.81% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G66055)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422582.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;