Protein coding transcript 158484

• Transcript: Ll_transcript_106815
• CDS coordinates: 48-1286 (+)
• Peptide sequence: MGRYSISYSLVFTTIFSTLPLFITTIFLCSSTLQTKVESLPLSTNGRWIVNENGKRVKLACVNWVSHSETMLAQGLNKRPLDELSKSIKDMGFNCVRLTWPILLATNDSLASITIRDHFNSLGLVQTIIDIQKNNPSIVDLSLIKAFQAVVKSLGEKEVMVILDNHVTQPQWCCGNNDGNGFFGDIYFDPDLWIKGLSKMADMFKGVSNVVGMSMRNELRGPKQNVPDWYRYMPKGAEAVHAANPNVLVILSGLNFDTDLSFIQNQPVTLSFKGKLVFEVHWYSFTDGNTWASMNPNQACAQITGNVMRKAGFLLDQGWPLFLSEFGIDLRGINVDEHRYLNCFMTLASGLDFDWALWTLVGSYYLREGVVEMNEYYGILDSDWSHIRNQTFLQKISAIQLPFQGKITTKHY*
• ORF Type: complete

Annotations of Ll_transcript_106815

• Blastp: Endoglucanase E1 from Acidothermus with 25.54% of identity
• Blastx: Endoglucanase E1 from Acidothermus with 25.54% of identity
• Eggnog: Glycoside hydrolase Family 5(COG2730)
• Kegg: Link to kegg annotations (Acel_0614)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438342.1)
• Pfam: Cellulase (glycosyl hydrolase family 5) (PF00150.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;