Protein coding transcript 158485

• Transcript: Ll_transcript_106816
• CDS coordinates: 124-804 (+)
• Peptide sequence: MGKWSCSLAFLFLSWLQLSIITTLLSKAIIEVKGVPLHTDSRWIVNEDGKRVKLACVNWVSHLDAVVAEGLSKQPVDVISNRIKTMGFNCVRLTWPIFLATNDSFASLTVRDSFRSLALIESVAGVQSNNPSIIDLTLIQAFQAVVKSLGDNDVMVILDNHITRPGWCCSNNDGNGFFGDQYFDPNMWIQGLTKMATIFNGMNNVVGMSLRNELRGPRQNVNDWYR*
• ORF Type: complete

Annotations of Ll_transcript_106816

• Blastp: Endoglucanase from Paenibacillus with 26.67% of identity
• Blastx: Endoglucanase from Paenibacillus with 26.67% of identity
• Eggnog: Glycoside hydrolase Family 5(COG2730)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464045.1)
• Pfam: Cellulase (glycosyl hydrolase family 5) (PF00150.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;