Protein coding transcript 158505

• Transcript: Ll_transcript_106945
• CDS coordinates: 179-943 (+)
• Peptide sequence: MASHIAFFHASPFSIPTQQQQRLFYPKHSRLIINTLKPTTPTTSSSFFPCSTVTTKRRFVSQVISCSYSNGRVPDSAEEEEEDGVKSAERLREEKRRAELSARIASGEFTVQEQPGLPSILKKSILKVGVPKEAVEFLFGWVEGRGGYPKIPEAKGSISAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAYSKGILAEILEFVMGKGLIPADEETWRVRRRVIAPALHQKVSLLD*
• ORF Type: complete

Annotations of Ll_transcript_106945

• Blastp: Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 70.39% of identity
• Blastx: Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 86.09% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT1G31800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429423.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;