Protein coding transcript 158535

• Transcript: Ll_transcript_106413
• CDS coordinates: 1276-1722 (+)
• Peptide sequence: MGSLICASFAASSLIRQVIKYASSIPTCRAVYLHVISYNNPAIYLYKKMSFKCIRRLQGFYLINDQQYDSYLFLYYVNGGRSPCSPLELLAAMVSYMRSGFKLVAAKLCKSEERKVSRWSKCKESHSLVSVTHNKRNLAVECTGYECV*
• ORF Type: complete

Annotations of Ll_transcript_106413

• Blastp: Histone acetyltransferase MCC1 from Arabidopsis with 54.78% of identity
• Blastx: Histone acetyltransferase MCC1 from Arabidopsis with 54.78% of identity
• Eggnog: N(alpha)-acetyltransferase 60, NatF catalytic subunit(ENOG410Y94A)
• Kegg: Link to kegg annotations (AT3G02980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454346.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;