Protein coding transcript 158537

• Transcript: Ll_transcript_106420
• CDS coordinates: 344-928 (+)
• Peptide sequence: MVNPKLSTRPKICYRPIRPSDFEILEHIHVKLFPIRYESTFFQDVVNGRDIVSWGAVDSSRPDGQSDELIGFVTARIVLAKESEIVDMLGYDSSKSDQTLVYILTLGVVDSYRNHGIASSLIRQVIKYASSIPTCRAVYLHVISYNNPAIYLYKKMSFKCIRRLQGFYLINDQQYDSYLFLYYVNGGRSPCSPL*
• ORF Type: complete

Annotations of Ll_transcript_106420

• Blastp: Histone acetyltransferase MCC1 from Arabidopsis with 64.43% of identity
• Blastx: Histone acetyltransferase MCC1 from Arabidopsis with 64.62% of identity
• Eggnog: N(alpha)-acetyltransferase 60, NatF catalytic subunit(ENOG410Y94A)
• Kegg: Link to kegg annotations (AT3G02980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454346.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;