Protein coding transcript 158561

• Transcript: Ll_transcript_106296
• CDS coordinates: 2-343 (+)
• Peptide sequence: DRRRDKFFDELEIVFADVVMAILADFMLVYLPAPTVSLRPPLAINAGHIAKFFHNCPDNAFQVALSGTPYSLLQRIGAIVRNGSKLFAVGTASSLVSFLSSSAPYAPFSGLKF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_106296

• Blastp: Protein RETICULATA-RELATED 4, chloroplastic from Arabidopsis with 82.29% of identity
• Blastx: Protein RETICULATA-RELATED 4, chloroplastic from Arabidopsis with 82.42% of identity
• Eggnog: Domain of unknown function (DUF3411)(ENOG410YJYE)
• Kegg: Link to kegg annotations (AT5G12470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454320.1)
• Pfam: Protein RETICULATA-related (PF11891.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;