Transcript | Ll_transcript_106124 |
---|---|
CDS coordinates | 192-629 (+) |
Peptide sequence | MSPPQLGIGDEEGESNVTLLVSSSTTMESVCLNGSKLKEFNYMGLSDSSSVDSSVPSFSSPDENKSNLNLKATELRLGLPGSQSPERDSDLCFRSSTQFDEKLLFPLRPAVDDHHSSSKPAVLGNKRGFSDAMNEFSEVKLIVSSD |
ORF Type | 3prime_partial |
Blastp | Auxin-responsive protein IAA8 from Arabidopsis with 58.88% of identity |
---|---|
Blastx | Auxin-responsive protein IAA8 from Arabidopsis with 58.49% of identity |
Eggnog | auxin-responsive protein(ENOG4111VTJ) |
Kegg | Link to kegg annotations (AT2G22670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456586.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer