Protein coding transcript 158587

• Transcript: Ll_transcript_106132
• CDS coordinates: 185-622 (+)
• Peptide sequence: MSPPQLGIGDEEGESNVTLLVSSSTTMESVCLNGSKLKEFNYMGLSDSSSVDSSVPSFSSPDENKSNLNLKATELRLGLPGSQSPERDSDLCFRSSTQFDEKLLFPLRPAVDDHHSSSKPAVLGNKRGFSDAMNEFSEVKLIVSSD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_106132

• Blastp: Auxin-responsive protein IAA8 from Arabidopsis with 58.88% of identity
• Blastx: Auxin-responsive protein IAA8 from Arabidopsis with 58.49% of identity
• Eggnog: auxin-responsive protein(ENOG4111VTJ)
• Kegg: Link to kegg annotations (AT2G22670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456586.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;