| Transcript | Ll_transcript_106433 |
|---|---|
| CDS coordinates | 1-315 (+) |
| Peptide sequence | QATIVRGVVLISGMGRQPCCDKLGVKKGPWTTEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYLRPDLKRGLLTEAEEQLVIDLHARLGNRFYI* |
| ORF Type | 5prime_partial |
| Blastp | Protein ODORANT1 from Petunia with 91.01% of identity |
|---|---|
| Blastx | Protein ODORANT1 from Petunia with 91.01% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422294.1) |
| Pfam | Myb-like DNA-binding domain (PF00249.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer