Protein coding transcript 158653

• Transcript: Ll_transcript_106529
• CDS coordinates: 1-534 (+)
• Peptide sequence: KPFFSNFGAIVTFAIFGTFVSSIVTGVLVYLGGLIYLMYRLPLVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAVSFCCYNFCFVLVLLLFVFKCSKWLISSFLPFVFFSFDITSLIHYGQMAISLYRTMSMVKADPSGQNLFMVVIRFLETFFGSMSAGQTRT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_106529

• Blastp: Sodium/hydrogen exchanger 6 from Arabidopsis with 60.12% of identity
• Blastx: Sodium/hydrogen exchanger 6 from Arabidopsis with 59.54% of identity
• Eggnog: Sodium hydrogen exchanger(COG0025)
• Kegg: Link to kegg annotations (AT1G79610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426014.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;