Protein coding transcript 158660

• Transcript: Ll_transcript_106508
• CDS coordinates: 1318-1851 (+)
• Peptide sequence: MKTTNDAVLLAIKAIFILKSVCFFPTYLRFLVSIIQLYDYRWIDLQEMHKKLIHRLHDGMKEASTSEVNKILGCYKEAEIGFGAAYNIETSILNSIFDCPFLGVRLKDPNSIVICILASSVPINDSDIAAFVGTFRQTTEYKRDIILSTVHEPNVEPNQLITTVLTLGYLEIWKNLW*
• ORF Type: complete

Annotations of Ll_transcript_106508

• Blastp: Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3 from Arabidopsis with 51.2% of identity
• Blastx: Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3 from Arabidopsis with 45.42% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT1G75010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452630.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;