Protein coding transcript 158729

• Transcript: Ll_transcript_106205
• CDS coordinates: 157-960 (+)
• Peptide sequence: MGLVKFATTIFTVITLLGSLAPSQIEATFKCSTTNATCHSLVDYKNPKGTTLRYIQTLFNVKHLQDILGANNLPTNTIGNYSVGPNEAIKVPFPCKCNNGTGLSNHVPVYTIKAGDGLYDIATTTFAGLVTFPQIQEVNNVTDANKITAGDKLWIPLPCSCDEVGGESVVHYGHIVESGNSVEGIANKYGTTQQLLLSLNGISDPKSLQAGQVLDVPLKGIHPFIQFPPFCFLITLQHRSLILQGCLIMCLWLLFIFNFFIHIIISD*
• ORF Type: complete

Annotations of Ll_transcript_106205

• Blastp: LysM domain-containing GPI-anchored protein 2 from Arabidopsis with 49.12% of identity
• Blastx: LysM domain-containing GPI-anchored protein 2 from Arabidopsis with 49.55% of identity
• Eggnog: domain protein(ENOG410XV98)
• Kegg: Link to kegg annotations (AT2G17120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464409.1)
• Pfam: LysM domain (PF01476.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;