Transcript | Ll_transcript_106212 |
---|---|
CDS coordinates | 2-331 (+) |
Peptide sequence | KKKKKRRKKKKKKKKEEEEENMGLVKFATTIFTVITLLGSLAPSQIEATFKCSTTNATCHSLVDYKNPKGTTLRYIQTLFNVKHLQDILGANNLPTNTIGTNKFISSLT* |
ORF Type | 5prime_partial |
Blastp | LysM domain-containing GPI-anchored protein 2 from Arabidopsis with 52% of identity |
---|---|
Blastx | LysM domain-containing GPI-anchored protein 2 from Arabidopsis with 50% of identity |
Eggnog | domain protein(ENOG410XV98) |
Kegg | Link to kegg annotations (AT2G17120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464409.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer