Protein coding transcript 158739

• Transcript: Ll_transcript_106225
• CDS coordinates: 254-619 (+)
• Peptide sequence: MIQVSPATGIIRPDHMVEVSVHHEEFQTLEEFVDGVVQNSWCEDSRDMEAILVVKVRGNCTSQTRDHRVRVHHCYSAKKNQTESQPNNSSDIQASVLRRSDFQRLSSSYDVVDKLHNLHCP*
• ORF Type: complete

Annotations of Ll_transcript_106225

• Blastp: Type II inositol polyphosphate 5-phosphatase 15 from Arabidopsis with 50% of identity
• Blastx: Type II inositol polyphosphate 5-phosphatase 15 from Arabidopsis with 50% of identity
• Eggnog: inositol(COG5411)
• Kegg: Link to kegg annotations (AT1G65580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428901.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;