Transcript | Ll_transcript_106252 |
---|---|
CDS coordinates | 2617-3186 (+) |
Peptide sequence | MYSSYLYLQAFSGTQNVSSLQKDEAWRVNVRIQGCDLEHGYLCGTMEALNVPMADTPVVTFWEGEIVDTKNYTFFTGKWEATPEDDIRHWTKFPSFSPLLAQVEVDGGKTLDLSNYPYIFMRWKEQYFVNVGTDCGLTIAGFYYVCFSCSDGSISGFYYDPNSSPFQKLELKSTNDGRSGFSFSSYELQ* |
ORF Type | complete |
Blastp | Glucose-induced degradation protein 4 homolog from Mus with 36.59% of identity |
---|---|
Blastx | Glucose-induced degradation protein 4 homolog from Mus with 34.64% of identity |
Eggnog | GID complex subunit 4, VID24 homolog (S. cerevisiae)(COG5073) |
Kegg | Link to kegg annotations (66771) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004506631.1) |
Pfam | Vacuolar import and degradation protein (PF09783.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer