Protein coding transcript 158768

• Transcript: Ll_transcript_106635
• CDS coordinates: 936-1631 (+)
• Peptide sequence: MRYFSFLFKLAVKKIYFSLLTLSLNDNQSTITISGQVDLFKEYIRKLEGEVGVDRTNFILANSVFLAVFGSNDISNTYFLSRLRQVQYDFPAYTDFLVTLASNFLKEIYELGARRIGVFSVPPIGCLPSQRTIAGGIERKCVARYNEAAELFNRKLSKELNSFNKNLENSRIVFIDIYNPLLDIIVNYQKYGYEVGDKGCCGTGIIEVVELCNRFVPTCPNDLEYVFWDSFH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_106635

• Blastp: GDSL esterase/lipase EXL2 from Arabidopsis with 49.77% of identity
• Blastx: GDSL esterase/lipase EXL2 from Arabidopsis with 47.26% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT1G75890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433878.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;