Protein coding transcript 158781

• Transcript: Ll_transcript_106655
• CDS coordinates: 492-989 (+)
• Peptide sequence: MFKEYIGKLQGLIGKDRTNFILANSIFFVVLGSNDISNTYFLSHIRQLQYDIPSYTDIMINSASKFLEEIYELGARRIGVFSTPPVGCVPFQRTMAGGIERKCVENYNNAMELFNSKLSKQIDSFSHKFPNTRIAYIDVYTPLLDIILNPKKYGYKVGDRGCCGTG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_106655

• Blastp: GDSL esterase/lipase EXL3 from Arabidopsis with 51.52% of identity
• Blastx: GDSL esterase/lipase EXL3 from Arabidopsis with 50.57% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT1G75900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449471.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;