Protein coding transcript 158792

• Transcript: Ll_transcript_106632
• CDS coordinates: 163-486 (+)
• Peptide sequence: MGPLMKLSSPLAFCSSMLLCFIELLLMSCKIKGVMELPPNVSVPAVIVFGDSIMDTGNNNNNMQTWARCNFAPYGKDFPGGIPTGRFSNGKVPSDLIGISFSELCLL*
• ORF Type: complete

Annotations of Ll_transcript_106632

• Blastp: GDSL esterase/lipase At5g42170 from Arabidopsis with 62.69% of identity
• Blastx: GDSL esterase/lipase At5g42170 from Arabidopsis with 62.69% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT5G42170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416732.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;