Transcript | Ll_transcript_104842 |
---|---|
CDS coordinates | 374-1453 (+) |
Peptide sequence | MGNSFGCSASGERLVSAARDGDLVEAKVLLEWNPGLAKYSTFGGLNSPLHFAASKGHNEIVTLLLENGADVNLRNYCGQTPLMQACRYGHWEVVQTLLLFKCNVVRADYLSNRTALHFAAVNGHVRCLRLVVADFVPSAPYEALYARSDADTTDGSDVKSKGEQSELSKFVNKVAEGGITALHMAALNGHFDCVQLLLDLNANVSTTTIHHGTSIDIIGPGSTPLHYAACGGSLKCCQILLARGASRMIVNCNEWLPLDIARMWGRYWLEPLLAPISDAAIPSFPSSKYLSLPLMSVLNIARSINQSDCIVGPSTCLVGMNNGTCKSQNQAFKGNNCFLTSGAGDKDKVTITFLWMLPI* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase XBAT33 from Arabidopsis with 75.64% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase XBAT33 from Arabidopsis with 75.64% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT5G07270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464952.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer