Protein coding transcript 158834

• Transcript: Ll_transcript_104846
• CDS coordinates: 399-1079 (+)
• Peptide sequence: MEMELRFSRNNCREFRLQSSTTSSNGIEFCAVCLETPCSVAAEGCGHELCVSCALHLCSTSNGSRDIVSPPGSIPCPLCRHGIVSFVKLPGSQAKENKQNVSLRLCTPCMLHPRDVHRPALSHASEIRRNRVASVSSETICSITCTPFPSMAIPLCTCNGGSCPSFQSREVETGDEPSHSSQASALDQNKTEGPRVEKTSCTNMFRARRSCSREHRCDSEINTGTQ*
• ORF Type: complete

Annotations of Ll_transcript_104846

• Blastp: Probable E3 ubiquitin-protein ligase XBOS33 from Oryza sativa with 48.6% of identity
• Blastx: Probable E3 ubiquitin-protein ligase XBOS33 from Oryza sativa with 48.6% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (9266159)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464952.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;